DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and CBL8

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001319319.1 Gene:CBL8 / 842756 AraportID:AT1G64480 Length:214 Species:Arabidopsis thaliana


Alignment Length:214 Identity:53/214 - (24%)
Similarity:102/214 - (47%) Gaps:38/214 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 KRQQRQRRMDELSGKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAI 157
            ||.:..|      |..:|.:|.|   :|.||.:|::||..:::||                |.:|
plant    11 KRAKHPR------GYEDPHVLAS---ETPFTVNEIEALHDLFKKL----------------STSI 50

  Fly   158 AKPHAAVEGIDRIVFRE--LLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRG 220
            ..        |.::.:|  ||....:...:.:..:|:|..:|:...|: :....::..||.|...
plant    51 IN--------DGLIHKEEFLLALFRNGSMQNLFADRVFYMFDRKRNGV-IEFGEFVRSLSIFHPY 106

  Fly   221 TPA-ERAAFCFRVYDLNTDGFITKDEMFTLLRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDG 284
            ||. |::||.|:::||:..|||...|:..:: ..|:.:...|..:|.::.:||..:.:.|.:|||
plant   107 TPEHEKSAFMFKLFDLHGTGFIEPHELKKMV-GALLGETDLELSEESIEAIVEQTMLEVDTNKDG 170

  Fly   285 KVSLEDFMGTVTAEPLLIE 303
            |:..|::...|...|.:::
plant   171 KIDEEEWKELVAKNPSILK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 19/63 (30%)
EF-hand_7 229..292 CDD:290234 18/62 (29%)
CBL8NP_001319319.1 FRQ1 29..187 CDD:227455 46/183 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.