DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and CBL2

DIOPT Version :10

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_200410.1 Gene:CBL2 / 835697 AraportID:AT5G55990 Length:226 Species:Arabidopsis thaliana


Alignment Length:200 Identity:51/200 - (25%)
Similarity:93/200 - (46%) Gaps:30/200 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 GKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEG-IDR 169
            |..:|:|   |.:.|.|:..|::||..:::|:               |||.|.      :| |::
plant    29 GLGDPEL---LARDTVFSVSEIEALYELFKKI---------------SSAVID------DGLINK 69

  Fly   170 IVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPA-ERAAFCFRVY 233
            ..|:..|..|..  .|.:..:|:|..:|..|.|: |..|.:...||.|....|. ::..|.|::|
plant    70 EEFQLALFKTNK--KESLFADRVFDLFDTKHNGI-LGFEEFARALSVFHPNAPIDDKIHFSFQLY 131

  Fly   234 DLNTDGFITKDEMFTLLRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFMGTVTAE 298
            ||...|||.:.|:..::...|.:...:. .|..::|:::...::.|...|||:..|::...|...
plant   132 DLKQQGFIERQEVKQMVVATLAESGMNL-KDTVIEDIIDKTFEEADTKHDGKIDKEEWRSLVLRH 195

  Fly   299 PLLIE 303
            |.|::
plant   196 PSLLK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 PRK12309 <103..290 CDD:183426 47/185 (25%)
EF-hand_7 224..292 CDD:463900 17/67 (25%)
CBL2NP_200410.1 FRQ1 64..192 CDD:444056 34/131 (26%)

Return to query results.
Submit another query.