DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and CBL3

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001320073.1 Gene:CBL3 / 828764 AraportID:AT4G26570 Length:230 Species:Arabidopsis thaliana


Alignment Length:204 Identity:51/204 - (25%)
Similarity:94/204 - (46%) Gaps:34/204 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 GKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEG-IDR 169
            |..:|:|   |.::|.|:..|::||..:::|:               |||.|.      :| |::
plant    29 GLGDPEL---LARETVFSVSEIEALYELFKKI---------------SSAVID------DGLINK 69

  Fly   170 IVFRELLHSTFDIVTEEILMER----IFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAE-RAAFC 229
            ..|:..|..|..  .|.:..:|    :|..:|..|.|: |..|.:...||.|....|.| :..|.
plant    70 EEFQLALFKTNK--KESLFADRYQSQVFDLFDTKHNGI-LGFEEFARALSVFHPNAPIEDKIDFS 131

  Fly   230 FRVYDLNTDGFITKDEMFTLLRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFMGT 294
            |::|||...|||.:.|:..::...|.:...:.. ||.::.:::...::.|...||::..|::...
plant   132 FQLYDLKQQGFIERQEVKQMVVATLAESGMNLS-DEIIESIIDKTFEEADTKHDGRIDKEEWRTL 195

  Fly   295 VTAEPLLIE 303
            |...|.|::
plant   196 VLRHPSLLK 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 16/63 (25%)
EF-hand_7 229..292 CDD:290234 15/62 (24%)
CBL3NP_001320073.1 EFh_PEF 40..202 CDD:330173 46/186 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.