DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and CBL6

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001328805.1 Gene:CBL6 / 827330 AraportID:AT4G16350 Length:226 Species:Arabidopsis thaliana


Alignment Length:198 Identity:46/198 - (23%)
Similarity:88/198 - (44%) Gaps:36/198 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 NPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEG-IDRIVF 172
            |||   .:.:.|.||.:|::||..:::.:..|                         | ||:..|
plant    30 NPK---DVARGTVFTVNEIEALYELFKSISKN-------------------------GLIDKEQF 66

  Fly   173 RELLHSTFDI-VTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAE-RAAFCFRVYDL 235
            :.:|   |.: .|..:..:|:|..:|..:.|: |..|.:...||.|......| :..|.|::|||
plant    67 QLVL---FKMNTTRSLFADRVFDLFDTKNTGI-LDFEAFARSLSVFHPNAKFEDKIEFSFKLYDL 127

  Fly   236 NTDGFITKDEMFTLLRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFMGTVTAEPL 300
            |..|:|.:.|:..::...|.:...:.. |..::.:::...::.|...|||:..|::...|...|.
plant   128 NQQGYIKRQEVKQMVVRTLAESGMNLS-DHVIESIIDKTFEEADTKLDGKIDKEEWRSLVLRHPS 191

  Fly   301 LIE 303
            |::
plant   192 LLQ 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 16/63 (25%)
EF-hand_7 229..292 CDD:290234 15/62 (24%)
CBL6NP_001328805.1 FRQ1 38..192 CDD:227455 42/183 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.