DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and EFCAB1

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_078869.1 Gene:EFCAB1 / 79645 HGNCID:25678 Length:211 Species:Homo sapiens


Alignment Length:209 Identity:93/209 - (44%)
Similarity:130/209 - (62%) Gaps:20/209 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KLLDSLRKKTR-FTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDRIVFRE 174
            ||.|:|.|..: |.|.|::.|.:::..||..                 .:....|.|:||..||.
Human     8 KLTDTLTKNCKHFNKFEVNCLIKLFYDLVGG-----------------VERQGLVVGLDRNAFRN 55

  Fly   175 LLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDLNTDG 239
            :||.||. :|::::|:|:|..:||.::|....|| |:.|||.||||:..|:..:||.|:|||.||
Human    56 ILHVTFG-MTDDMIMDRVFRGFDKDNDGCVNVLE-WIHGLSLFLRGSLEEKMKYCFEVFDLNGDG 118

  Fly   240 FITKDEMFTLLRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFMGTVTAEPLLIEA 304
            ||:|:|||.:|:|.|:|||.:||||||:||||||.|||.|.|.|||:|..|:...|..|.||:||
Human   119 FISKEEMFHMLKNSLLKQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFADYELAVREETLLLEA 183

  Fly   305 FGQCLPTDSAVVSF 318
            ||.|||...:.:.|
Human   184 FGPCLPDPKSQMEF 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 42/63 (67%)
EF-hand_7 229..292 CDD:290234 42/62 (68%)
EFCAB1NP_078869.1 EFh_PEF <48..170 CDD:330173 67/123 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I7287
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11608
Inparanoid 1 1.050 170 1.000 Inparanoid score I4128
Isobase 1 0.950 - 0 Normalized mean entropy S1834
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331864at2759
OrthoFinder 1 1.000 - - FOG0005764
OrthoInspector 1 1.000 - - oto90594
orthoMCL 1 0.900 - - OOG6_107931
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.