DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and rcvrnb

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001304684.1 Gene:rcvrnb / 792903 ZFINID:ZDB-GENE-120815-1 Length:203 Species:Danio rerio


Alignment Length:197 Identity:40/197 - (20%)
Similarity:87/197 - (44%) Gaps:38/197 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SGKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDR 169
            |..::..:|..|:..|.:::::|.:.   |:|.::.|....                     |.|
Zfish     6 SSALSRDVLQELQTSTTYSQEQLFSW---YQKFLNECPTGR---------------------ISR 46

  Fly   170 IVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYD 234
            ..|:.:..|.|.........:.:|.|:|...:| .|..:.:::.|.....|...|:..:.|.:||
Zfish    47 EQFQSIYASFFPDADPGAYAQHVFRSFDADSDG-TLDFKEYIVALHLTSSGKTVEKLEWAFALYD 110

  Fly   235 LNTDGFITKDEMFTLLR---NCLIKQ-----PQDED-PDEGVKDLVEIVLKKFDLDKDGKVSLED 290
            ::.:|.|||:|:..:::   |.:.|:     |.||: |::....:.:...||    ::||::..:
Zfish   111 VDRNGSITKNEIHEIVKSIFNMISKEDQKNLPDDENTPEKRTDKIWDFFGKK----ENGKITEGE 171

  Fly   291 FM 292
            |:
Zfish   172 FI 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 18/72 (25%)
EF-hand_7 229..292 CDD:290234 18/71 (25%)
rcvrnbNP_001304684.1 FRQ1 10..182 CDD:227455 39/193 (20%)
EFh 65..127 CDD:238008 16/62 (26%)
EFh 101..177 CDD:238008 19/77 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.