Sequence 1: | NP_572437.2 | Gene: | CG2256 / 31727 | FlyBaseID: | FBgn0029995 | Length: | 324 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001304684.1 | Gene: | rcvrnb / 792903 | ZFINID: | ZDB-GENE-120815-1 | Length: | 203 | Species: | Danio rerio |
Alignment Length: | 197 | Identity: | 40/197 - (20%) |
---|---|---|---|
Similarity: | 87/197 - (44%) | Gaps: | 38/197 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 105 SGKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDR 169
Fly 170 IVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYD 234
Fly 235 LNTDGFITKDEMFTLLR---NCLIKQ-----PQDED-PDEGVKDLVEIVLKKFDLDKDGKVSLED 290
Fly 291 FM 292 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2256 | NP_572437.2 | EFh | 228..292 | CDD:238008 | 18/72 (25%) |
EF-hand_7 | 229..292 | CDD:290234 | 18/71 (25%) | ||
rcvrnb | NP_001304684.1 | FRQ1 | 10..182 | CDD:227455 | 39/193 (20%) |
EFh | 65..127 | CDD:238008 | 16/62 (26%) | ||
EFh | 101..177 | CDD:238008 | 19/77 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X31 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |