DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and 1700109H08Rik

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_084119.1 Gene:1700109H08Rik / 77036 MGIID:1924286 Length:210 Species:Mus musculus


Alignment Length:215 Identity:84/215 - (39%)
Similarity:125/215 - (58%) Gaps:25/215 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KLLDSLRKKTR-FTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVE--GIDRIVF 172
            |:::|:||..: |.|.|::.|.|::..|| .|                  |...::  |:|...|
Mouse     8 KMVESIRKTVKSFKKFEVECLIRLFYSLV-GC------------------PVGKMDNTGLDCNTF 53

  Fly   173 RELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDLNT 237
            |.:|.:.|. :|.::||.|:|..:||..:|. :.||.|:.||:.|||||..|:..|||.||.||.
Mouse    54 RGVLQNIFG-MTNDMLMNRVFFVFDKDGDGY-VNLEEWIKGLAVFLRGTFEEKMRFCFEVYYLNG 116

  Fly   238 DGFITKDEMFTLLRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFMGTVTAEPLLI 302
            |.:|:::::|.:|::.|.:...:|:.:|||||||||.|||.|.|.|||:|..||...|..:.||:
Mouse   117 DAYISQEKIFDMLKSSLFQHSPEEENEEGVKDLVEISLKKMDYDNDGKISFADFEKAVKEDGLLL 181

  Fly   303 EAFGQCLPTDSAVVSFFSTL 322
            ||||.||| |:.....|..|
Mouse   182 EAFGPCLP-DAKFCFHFEAL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 32/63 (51%)
EF-hand_7 229..292 CDD:290234 31/62 (50%)
1700109H08RikNP_084119.1 EFh 71..130 CDD:298682 26/59 (44%)
EF-hand_7 105..174 CDD:290234 33/68 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833418
Domainoid 1 1.000 96 1.000 Domainoid score I7312
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I4073
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005764
OrthoInspector 1 1.000 - - otm43720
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.850

Return to query results.
Submit another query.