DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and hpca

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_012812581.2 Gene:hpca / 733559 XenbaseID:XB-GENE-491920 Length:234 Species:Xenopus tropicalis


Alignment Length:222 Identity:51/222 - (22%)
Similarity:105/222 - (47%) Gaps:37/222 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 RMDELSGKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAV 164
            :|.:.:.|:.|::|..||:.|.|:..||.   ..|:..:.:|.                      
 Frog    41 KMGKQNSKLRPEMLQDLRENTEFSDHELQ---EWYKGFLKDCP---------------------- 80

  Fly   165 EGIDRI-VFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAF 228
            .||..: .|:::..:.|.........|.:|.::|...:| .:....::|.||...||...::..:
 Frog    81 SGILNVEEFKKIYANFFPYGDASKFAEHVFRTFDTNGDG-TIDFREFIIALSVTSRGKLEQKLKW 144

  Fly   229 CFRVYDLNTDGFITKDEMFTLLR------NCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVS 287
            .|.:|||:.:|:|:::||..:::      :.::|.|:||...|   ...|.:.::.|.:.|||:|
 Frog   145 AFSMYDLDGNGYISREEMLEIVQAIYKMVSSVMKMPEDESTPE---KRTEKIFRQMDTNNDGKLS 206

  Fly   288 LEDFMGTVTAEPLLIEAFGQCLPTDSA 314
            ||:|:....::|.::... ||.|:.::
 Frog   207 LEEFIKGAKSDPSIVRLL-QCDPSTAS 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 21/69 (30%)
EF-hand_7 229..292 CDD:290234 21/68 (31%)
hpcaXP_012812581.2 FRQ1 54..220 CDD:227455 45/194 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.