DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and hpcal1

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_031757604.1 Gene:hpcal1 / 733484 XenbaseID:XB-GENE-947040 Length:258 Species:Xenopus tropicalis


Alignment Length:205 Identity:47/205 - (22%)
Similarity:87/205 - (42%) Gaps:42/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 MDELSGKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVE 165
            |.:.:.|:.|::|..||:.|.||..||.   ..|:..:.:|...                |..||
 Frog     1 MGKQNSKLRPEVLQDLRENTEFTDHELQ---EWYKGFLKDCPTG----------------HLTVE 46

  Fly   166 GIDRIVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCF 230
                 .|:::..:.|.........|.:|.::|...:| .:....::|.||...||...::..:.|
 Frog    47 -----EFKKIYANFFPYGDASKFAEHVFRTFDTNGDG-TIDFREFIIALSVTSRGKLEQKLKWAF 105

  Fly   231 RVYDLNTDGFITKDEMFTLLR------NCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDG----- 284
            .:|||:.:|:|::.||..:::      :.::|.|:||...|...|.   :.|:.|.:.|.     
 Frog   106 SMYDLDGNGYISRGEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDK---IFKQMDTNNDALSYYV 167

  Fly   285 ---KVSLEDF 291
               |...||:
 Frog   168 TGLKCIKEDY 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 20/78 (26%)
EF-hand_7 229..292 CDD:290234 20/77 (26%)
hpcal1XP_031757604.1 FRQ1 13..162 CDD:227455 40/176 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.