DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and Kcnip3

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_017447516.1 Gene:Kcnip3 / 65199 RGDID:70888 Length:290 Species:Rattus norvegicus


Alignment Length:192 Identity:54/192 - (28%)
Similarity:93/192 - (48%) Gaps:36/192 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDRIVFRE 174
            |:.||.|:.:|:|||.||.:|   ||...:.|....                     :|...|: 
  Rat   110 PEGLDQLQAQTKFTKKELQSL---YRGFKNECPTGL---------------------VDEDTFK- 149

  Fly   175 LLHSTF----DIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDL 235
            |::|.|    |..|   ....:|.::|....| .:..|.:::|||..||||..|:..:.|.:||:
  Rat   150 LIYSQFFPQGDATT---YAHFLFNAFDADGNG-AIHFEDFVVGLSILLRGTVHEKLKWAFNLYDI 210

  Fly   236 NTDGFITKDEMFTLLRNCLIKQPQDEDP---DEGVKDLVEIVLKKFDLDKDGKVSLEDFMGT 294
            |.||:|||:||..::::......:...|   ::...:.||...:|.|.::||.|::::|:.|
  Rat   211 NKDGYITKEEMLAIMKSIYDMMGRHTYPILREDAPLEHVERFFQKMDRNQDGVVTIDEFLET 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 19/66 (29%)
EF-hand_7 229..292 CDD:290234 19/65 (29%)
Kcnip3XP_017447516.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.