DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and Kcnip1

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_006246167.1 Gene:Kcnip1 / 65023 RGDID:70886 Length:245 Species:Rattus norvegicus


Alignment Length:186 Identity:48/186 - (25%)
Similarity:85/186 - (45%) Gaps:28/186 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDRIVFRE 174
            |:.|:.|..:|.|||.||..|   ||...:.|                  |...|   :...|::
  Rat    65 PEGLEQLEAQTNFTKRELQVL---YRGFKNEC------------------PSGVV---NEETFKQ 105

  Fly   175 LLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDLNTDG 239
            :....|...........:|.::|....| .::.|.::..||..||||..|:..:.|.:||:|.||
  Rat   106 IYAQFFPHGDASTYAHYLFNAFDTTQTG-SVKFEDFVTALSILLRGTVHEKLRWTFNLYDINKDG 169

  Fly   240 FITKDEMFTLLR---NCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFM 292
            :|.|:||..:::   :.:.|.......::..:..|::..:|.|.:|||.|:|::|:
  Rat   170 YINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMDKNKDGIVTLDEFL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 19/66 (29%)
EF-hand_7 229..292 CDD:290234 19/65 (29%)
Kcnip1XP_006246167.1 FRQ1 68..234 CDD:227455 47/183 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.