DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and RCVRN

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_002894.1 Gene:RCVRN / 5957 HGNCID:9937 Length:200 Species:Homo sapiens


Alignment Length:207 Identity:43/207 - (20%)
Similarity:91/207 - (43%) Gaps:39/207 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SGKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDR 169
            ||.::.::|:.|:..|:|:::|   ||..|:..:.:|....                     |.:
Human     6 SGALSKEILEELQLNTKFSEEE---LCSWYQSFLKDCPTGR---------------------ITQ 46

  Fly   170 IVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYD 234
            ..|:.:....|.....:...:.:|.|:|...:| .|..:.::|.|.....|...::..:.|.:||
Human    47 QQFQSIYAKFFPDTDPKAYAQHVFRSFDSNLDG-TLDFKEYVIALHMTTAGKTNQKLEWAFSLYD 110

  Fly   235 LNTDGFITKDEMFTLLRNCLIKQ---------PQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLED 290
            ::.:|.|:|:|:..::. .:.|.         |.||:..|   ...|.:.|.|..:.|.|::.::
Human   111 VDGNGTISKNEVLEIVM-AIFKMITPEDVKLLPDDENTPE---KRAEKIWKYFGKNDDDKLTEKE 171

  Fly   291 FM-GTVTAEPLL 301
            |: ||:..:.:|
Human   172 FIEGTLANKEIL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 17/72 (24%)
EF-hand_7 229..292 CDD:290234 17/71 (24%)
RCVRNNP_002894.1 FRQ1 14..182 CDD:227455 40/196 (20%)
Interaction with GRK1. /evidence=ECO:0000250|UniProtKB:P21457 189..192
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.