Sequence 1: | NP_572437.2 | Gene: | CG2256 / 31727 | FlyBaseID: | FBgn0029995 | Length: | 324 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_002894.1 | Gene: | RCVRN / 5957 | HGNCID: | 9937 | Length: | 200 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 43/207 - (20%) |
---|---|---|---|
Similarity: | 91/207 - (43%) | Gaps: | 39/207 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 105 SGKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDR 169
Fly 170 IVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYD 234
Fly 235 LNTDGFITKDEMFTLLRNCLIKQ---------PQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLED 290
Fly 291 FM-GTVTAEPLL 301 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2256 | NP_572437.2 | EFh | 228..292 | CDD:238008 | 17/72 (24%) |
EF-hand_7 | 229..292 | CDD:290234 | 17/71 (24%) | ||
RCVRN | NP_002894.1 | FRQ1 | 14..182 | CDD:227455 | 40/196 (20%) |
Interaction with GRK1. /evidence=ECO:0000250|UniProtKB:P21457 | 189..192 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0044 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X31 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |