Sequence 1: | NP_572437.2 | Gene: | CG2256 / 31727 | FlyBaseID: | FBgn0029995 | Length: | 324 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_957119.2 | Gene: | rcvrn3 / 572207 | ZFINID: | ZDB-GENE-040426-1661 | Length: | 191 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 44/200 - (22%) |
---|---|---|---|
Similarity: | 81/200 - (40%) | Gaps: | 38/200 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 105 SGKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDR 169
Fly 170 IVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYD 234
Fly 235 LNTDGFITKDEMFTLLRNC--LI---KQ---PQDED-PDEGVKDLVEIVLKKFDLDKDGKVSLED 290
Fly 291 FMGTV 295 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG2256 | NP_572437.2 | EFh | 228..292 | CDD:238008 | 20/72 (28%) |
EF-hand_7 | 229..292 | CDD:290234 | 20/71 (28%) | ||
rcvrn3 | NP_957119.2 | FRQ1 | 16..179 | CDD:227455 | 40/189 (21%) |
EFh | 65..125 | CDD:238008 | 13/60 (22%) | ||
EFh | 101..177 | CDD:298682 | 21/79 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X31 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.000 |