DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and Kcnip2

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_064479.2 Gene:Kcnip2 / 56817 RGDID:70887 Length:270 Species:Rattus norvegicus


Alignment Length:226 Identity:65/226 - (28%)
Similarity:108/226 - (47%) Gaps:40/226 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 SNQQSKAAAAALQNKRQQRQRRMD--------ELSGKVN-PKLLDSLRKKTRFTKDELDALCRIY 134
            |..::.||.|:|   |..|.|.:|        |||...: |:.|:.|:::|:||:.||..|   |
  Rat    53 SVSETLAAPASL---RPHRPRPLDPDSVEDEFELSTVCHRPEGLEQLQEQTKFTRRELQVL---Y 111

  Fly   135 RKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDRIVFRELLHSTFDIVTEEILMERIFCSWDKA 199
            |...:.|                  |...|...:   |:::....|...........:|.::|..
  Rat   112 RGFKNEC------------------PSGIVNEEN---FKQIYSQFFPQGDSSNYATFLFNAFDTN 155

  Fly   200 HEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDLNTDGFITKDEMFTLLRNCLIKQPQDEDP- 263
            |:| .:..|.::.|||..||||..:|.::.|.:||||.||.|||:||..::::......:...| 
  Rat   156 HDG-SVSFEDFVAGLSVILRGTIDDRLSWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPA 219

  Fly   264 --DEGVKDLVEIVLKKFDLDKDGKVSLEDFM 292
              :|..::.||...:|.|.:|||.|::|:|:
  Rat   220 LREEAPREHVESFFQKMDRNKDGVVTIEEFI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 23/66 (35%)
EF-hand_7 229..292 CDD:290234 23/65 (35%)
Kcnip2NP_064479.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34
FRQ1 93..259 CDD:227455 52/183 (28%)
Interaction with KCND2. /evidence=ECO:0000250|UniProtKB:Q8R426 257..270
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.