DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and si:ch211-245j22.3

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001074270.1 Gene:si:ch211-245j22.3 / 563798 ZFINID:ZDB-GENE-050419-38 Length:194 Species:Danio rerio


Alignment Length:129 Identity:29/129 - (22%)
Similarity:61/129 - (47%) Gaps:15/129 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 ERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDLNTDGFITKDEMFTLLR--- 251
            |:||.:.|...:|: :....::..:|..:.|:..|:..:.|::||.:.||.||:.||..:::   
Zfish    58 EQIFRTLDNNGDGV-VDFREYVTAISMLIEGSTVEKLRWSFKLYDKDKDGAITRSEMLEIMQAVY 121

  Fly   252 ----NCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFM-GTVTAEPLLIEAFGQCLP 310
                ...:.:|   || ...::....:..:.|.|.:..:|.::|: |.:..|  .|....:|.|
Zfish   122 KMSVAASLTKP---DP-LTAEECTNRIFVRLDKDNNAIISQDEFIEGALNDE--WIREMLECDP 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 15/70 (21%)
EF-hand_7 229..292 CDD:290234 15/69 (22%)
si:ch211-245j22.3NP_001074270.1 EF-hand_8 31..78 CDD:290545 5/20 (25%)
EF-hand_7 32..81 CDD:290234 5/23 (22%)
EFh 56..118 CDD:238008 17/60 (28%)
EF-hand_7 57..117 CDD:290234 17/59 (29%)
EFh 92..164 CDD:238008 16/75 (21%)
EF-hand_7 93..163 CDD:290234 16/73 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.