DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and efcab1

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001038325.1 Gene:efcab1 / 558421 ZFINID:ZDB-GENE-040914-40 Length:216 Species:Danio rerio


Alignment Length:220 Identity:92/220 - (41%)
Similarity:135/220 - (61%) Gaps:20/220 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 RMDELSGKVNPKLLDSL-RKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAA 163
            :|..::.|:...|.::| |:...|.|.|.:.|.|::..|:.. |...||..              
Zfish     3 KMSAMNRKLIQNLAETLCRQVKHFNKTETECLIRLFNSLLGE-QAERKTTI-------------- 52

  Fly   164 VEGIDRIVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAF 228
              |:||..||.:||.||. :|::::.:|:....||.::|. |.::.|:..||.|||||..|:..:
Zfish    53 --GVDRAKFRNILHHTFG-MTDDMMTDRVCRVIDKDNDGY-LSVKEWVEALSVFLRGTLDEKMKY 113

  Fly   229 CFRVYDLNTDGFITKDEMFTLLRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFMG 293
            ||.|||||.||:|:::|||.:|::.||:||.:||||||:||:|||.|||.|.|.||:||..||..
Zfish   114 CFEVYDLNGDGYISREEMFQMLKDSLIRQPTEEDPDEGIKDIVEIALKKMDYDHDGRVSYADFEK 178

  Fly   294 TVTAEPLLIEAFGQCLPTDSAVVSF 318
            ||..|.||:||||.|||...:|::|
Zfish   179 TVMDENLLLEAFGNCLPDAKSVLAF 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 39/63 (62%)
EF-hand_7 229..292 CDD:290234 39/62 (63%)
efcab1NP_001038325.1 EFh 80..136 CDD:238008 26/56 (46%)
EF-hand_7 80..135 CDD:290234 26/55 (47%)
EFh 110..176 CDD:238008 38/65 (58%)
EF-hand_7 111..178 CDD:290234 40/66 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 94 1.000 Domainoid score I7477
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11608
Inparanoid 1 1.050 164 1.000 Inparanoid score I4174
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331864at2759
OrthoFinder 1 1.000 - - FOG0005764
OrthoInspector 1 1.000 - - oto41512
orthoMCL 1 0.900 - - OOG6_107931
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5830
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.860

Return to query results.
Submit another query.