DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and ncalda

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001107882.1 Gene:ncalda / 556178 ZFINID:ZDB-GENE-080220-28 Length:193 Species:Danio rerio


Alignment Length:219 Identity:49/219 - (22%)
Similarity:104/219 - (47%) Gaps:35/219 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 MDELSGKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVE 165
            |.:.:.|:.|:::..|.:.|.||:.|:.   ..|:..:.:|         .|.:.::.:      
Zfish     1 MGKQNSKLRPEVMQDLLESTDFTEHEIQ---EWYKGFLRDC---------PSGNLSMEE------ 47

  Fly   166 GIDRIVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCF 230
                  |:::..:.|.........|.:|.::|...:| .:....::|.||...||...::..:.|
Zfish    48 ------FKKIYGNFFPYGDASKFAEHVFRTFDANGDG-TIDFREFIIALSVTSRGKLEQKLKWAF 105

  Fly   231 RVYDLNTDGFITKDEMFTLLR------NCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLE 289
            .:|||:.:|:|:|.||..:::      :.::|.|:||...|   ...|.:.::.|.::|||:|||
Zfish   106 SMYDLDGNGYISKSEMLEIVQAIYKMVSSVMKMPEDESTPE---KRTEKIFRQMDTNRDGKLSLE 167

  Fly   290 DFMGTVTAEPLLIEAFGQCLPTDS 313
            :|:.....:|.::... ||.|:.:
Zfish   168 EFIKGAKTDPSIVRLL-QCDPSSA 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 22/69 (32%)
EF-hand_7 229..292 CDD:290234 22/68 (32%)
ncaldaNP_001107882.1 FRQ1 14..179 CDD:227455 43/192 (22%)
EFh <36..89 CDD:298682 9/74 (12%)
EFh 65..126 CDD:238008 18/61 (30%)
EFh 100..174 CDD:238008 23/76 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.