DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and efcab1

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001016778.1 Gene:efcab1 / 549532 XenbaseID:XB-GENE-5727529 Length:208 Species:Xenopus tropicalis


Alignment Length:225 Identity:96/225 - (42%)
Similarity:135/225 - (60%) Gaps:30/225 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 RQQRQRRMDELSGKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIA 158
            |:..|::.|.||           |....|:|:|:::|.|:|..||..                ..
 Frog     3 RKNLQKQADALS-----------RLIKHFSKNEVESLIRLYHTLVGR----------------PI 40

  Fly   159 KPHAAVEGIDRIVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPA 223
            .|:.. .||||..||.:||:||. :|::::|:|:|..:||.::.. :.:..|:.|||.|||||..
 Frog    41 DPNTR-RGIDRNTFRNILHNTFG-MTDDMIMDRVFRGFDKDNDSY-ISVTEWVEGLSVFLRGTLE 102

  Fly   224 ERAAFCFRVYDLNTDGFITKDEMFTLLRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSL 288
            ||..:||.|||||.||:|:::|||.:|:|.|:|||.:|||||||||||||.|||.|.|.|.|:|.
 Frog   103 ERIKYCFGVYDLNGDGYISREEMFHMLKNSLLKQPSEEDPDEGVKDLVEIALKKMDYDHDSKLSY 167

  Fly   289 EDFMGTVTAEPLLIEAFGQCLPTDSAVVSF 318
            .||...|..|.||:||||.|||....:::|
 Frog   168 MDFEKAVQEENLLLEAFGPCLPDSKCIMAF 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 41/63 (65%)
EF-hand_7 229..292 CDD:290234 41/62 (66%)
efcab1NP_001016778.1 EF-hand_7 69..129 CDD:290234 29/60 (48%)
EFh 71..130 CDD:238008 28/59 (47%)
EFh 104..175 CDD:238008 43/70 (61%)
EF-hand_7 105..174 CDD:290234 42/68 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7234
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11608
Inparanoid 1 1.050 171 1.000 Inparanoid score I3995
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331864at2759
OrthoFinder 1 1.000 - - FOG0005764
OrthoInspector 1 1.000 - - oto104394
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5830
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.