DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and LOC500007

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_006236139.1 Gene:LOC500007 / 500007 RGDID:1588445 Length:217 Species:Rattus norvegicus


Alignment Length:218 Identity:81/218 - (37%)
Similarity:123/218 - (56%) Gaps:31/218 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KLLDSLRKKTR-FTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEG--IDRIVF 172
            ||::|.||..: |.|.|::.|.:::..| :.|                  |...|:.  :|...|
  Rat     8 KLVESFRKTVKCFKKFEVECLIQLFYSL-AGC------------------PIGKVDNTKLDCNAF 53

  Fly   173 RELLHSTFDIVTEEILMERIFCSWDK---AHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYD 234
            |.:|.:.|. :|.::||.|:|..:||   :|    :.|:.|:.||:.|||||..|:..|||.||.
  Rat    54 RGVLQNFFG-MTNDVLMNRVFFVFDKDGDSH----VNLQEWIKGLAVFLRGTFEEKMRFCFEVYY 113

  Fly   235 LNTDGFITKDEMFTLLRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFMGTVTAEP 299
            |:.|.:|:::::|.:|::.|.....:|:.:||:||||||.|||.|.|.|||:|.|||...|..:.
  Rat   114 LSGDAYISREKIFDMLKSSLFHNSPEEENEEGIKDLVEISLKKMDYDNDGKISFEDFEKAVRKDG 178

  Fly   300 LLIEAFGQCLPTDSAVVSFFSTL 322
            ||:||||.||| |:.....|..|
  Rat   179 LLLEAFGPCLP-DAKTCFHFEAL 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 31/63 (49%)
EF-hand_7 229..292 CDD:290234 30/62 (48%)
LOC500007XP_006236139.1 EFh 104..175 CDD:298682 32/70 (46%)
EF-hand_7 105..174 CDD:290234 32/68 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336973
Domainoid 1 1.000 96 1.000 Domainoid score I7142
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 171 1.000 Inparanoid score I4020
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1331864at2759
OrthoFinder 1 1.000 - - FOG0005764
OrthoInspector 1 1.000 - - otm45796
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.