DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and rcvrn.2

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001008164.1 Gene:rcvrn.2 / 493526 XenbaseID:XB-GENE-5807318 Length:193 Species:Xenopus tropicalis


Alignment Length:196 Identity:42/196 - (21%)
Similarity:80/196 - (40%) Gaps:36/196 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SGKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDR 169
            ||.::.::|:.|:..||::.||   ||:.|.              |.|..:...|       |.|
 Frog     6 SGALSKEVLEDLKANTRYSDDE---LCKWYE--------------SFSKQSPNGK-------ITR 46

  Fly   170 IVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYD 234
            ..|.::..:.|.....:.....:|.|:|...:| .|....::|.|.....|..:.:..:.|.::|
 Frog    47 TEFEKIYANFFPNSDPKSYARHVFRSFDTNEDG-TLDFREYIIALHLTSSGKTSLKLEWAFSLFD 110

  Fly   235 LNTDGFITKDEMFTLLRNCLIKQP--------QDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDF 291
            ::.:|.|:|.|:..::.......|        .||:..:...|.:....||.|   |.|::..:|
 Frog   111 VDKNGEISKVEVLEIITAIFKMIPPEEQKNLADDENTPQKRADKLWAYFKKSD---DAKIAEGEF 172

  Fly   292 M 292
            :
 Frog   173 I 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 15/71 (21%)
EF-hand_7 229..292 CDD:290234 15/70 (21%)
rcvrn.2NP_001008164.1 FRQ1 14..177 CDD:227455 40/188 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.