DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and CanB2

DIOPT Version :10

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_524874.2 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster


Alignment Length:177 Identity:39/177 - (22%)
Similarity:82/177 - (46%) Gaps:33/177 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 TRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDRIVFRELLHSTFDIVT 184
            :.|..||:..|.:.:|||            ...:|.|::        :|..:       :...:.
  Fly    13 SNFDADEIRRLGKRFRKL------------DLDNSGALS--------VDEFM-------SLPELQ 50

  Fly   185 EEILMERIFCSWDKAHEGLPLRLEGWLIGLSTF-LRGTPAERAAFCFRVYDLNTDGFITKDEMFT 248
            :..|::|:...:|....| .:..:.::.|:|.| ::|....:..|.||:||::.||:|:..|:|.
  Fly    51 QNPLVQRVIDIFDADGNG-EVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQ 114

  Fly   249 LLRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFMGTV 295
            :|:..:....:|..    ::.:|:..:...|.|:|||:|.::|...|
  Fly   115 VLKMMVGNNLKDTQ----LQQIVDKTIGFADKDEDGKISFDEFCSVV 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 PRK12309 <103..290 CDD:183426 37/170 (22%)
EF-hand_7 224..292 CDD:463900 19/67 (28%)
CanB2NP_524874.2 FRQ1 20..157 CDD:444056 35/168 (21%)

Return to query results.
Submit another query.