DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and CG5890

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster


Alignment Length:196 Identity:49/196 - (25%)
Similarity:91/196 - (46%) Gaps:30/196 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEG-IDRIVFR 173
            |..|:.|.::|:|||.|:..:   ||...:.|.                      || :....|:
  Fly    26 PVALEDLCRQTKFTKQEIRVM---YRGFKTECP----------------------EGVVHEDCFK 65

  Fly   174 ELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDLNTD 238
            ::....|......:....:|.::|....| .:.....|:.|||.|||:..||..:.|::||||.|
  Fly    66 DIYAKFFPHGNSSLYAHYVFKAFDVNCNG-AISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGD 129

  Fly   239 GFITKDEMFTL---LRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFMGTVTAEPL 300
            |.|::.|:..:   :...:.::|...:.|...:|.|:.|.:|.||::||.:::|:|:.....:.|
  Fly   130 GRISRGELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDL 194

  Fly   301 L 301
            :
  Fly   195 V 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 20/66 (30%)
EF-hand_7 229..292 CDD:290234 20/65 (31%)
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 47/188 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
43.940

Return to query results.
Submit another query.