DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and d-cup

DIOPT Version :10

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_650235.1 Gene:d-cup / 41580 FlyBaseID:FBgn0038089 Length:219 Species:Drosophila melanogaster


Alignment Length:101 Identity:20/101 - (19%)
Similarity:39/101 - (38%) Gaps:20/101 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 DWQSYRSSNLYNGELMLIVAQDGADKLNTSIASSTSTTTTTTDIPLELE-AKISILSSTTAPTTT 264
            |.:.|:|..:.|.:|.::                |.......|..:||: |.|:.........|.
  Fly   460 DVEEYKSQKIENDDLFVL----------------THFMDVLEDTAVELDAANITTFEGKLFDITV 508

  Fly   265 AQVLTTTTSSEPSTTTTPPTTTQTSSSNQTSTISNE 300
            .:|.....|.|.|..:   :::.:|.|::.|::..|
  Fly   509 EEVEEQEESKEGSAES---SSSSSSESDEESSVERE 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 PRK12309 <103..290 CDD:183426 16/89 (18%)
EF-hand_7 224..292 CDD:463900 12/68 (18%)
d-cupNP_650235.1 FRQ1 70..182 CDD:444056
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.