DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and sunz

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster


Alignment Length:227 Identity:53/227 - (23%)
Similarity:93/227 - (40%) Gaps:53/227 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDRIVFRELL 176
            |:.|....|.|:.:|:.:|..::.|      ||....:...|::.:........||         
  Fly    23 LIKSFAASTEFSTNEVVSLLIVFYK------YALNNRSRMMSTSQLYNLFLVSFGI--------- 72

  Fly   177 HSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYD------L 235
               ||:.    :::||  |.:...:|..:..|.|:.....|..|:..||..|.|.||.      |
  Fly    73 ---FDVT----IIDRI--SMNITQDGRSVSPEAWMRLFCVFFNGSLQERMKFAFEVYTSGGAVVL 128

  Fly   236 N-------TDGFITKDEMFTLLRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFMG 293
            |       .:.|.|.|:              |::.:|...|:.|.:..|||.||||.::.|::..
  Fly   129 NREVVGVAIEQFFTGDD--------------DDEVNELRADMCEFIFGKFDTDKDGVIAFEEYAE 179

  Fly   294 TVTAEPLLIEAFGQCLPTDS--AVVSFFSTLQ 323
            .|..:|.|:|..|:..|.|.  ::|::...::
  Fly   180 IVQNQPGLLEFLGKIFPDDKDRSLVAYCHNIE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 21/76 (28%)
EF-hand_7 229..292 CDD:290234 20/75 (27%)
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 21/81 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438937
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D106617at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.