DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and CG15177

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_649672.1 Gene:CG15177 / 40810 FlyBaseID:FBgn0037461 Length:225 Species:Drosophila melanogaster


Alignment Length:200 Identity:50/200 - (25%)
Similarity:80/200 - (40%) Gaps:63/200 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 KKTRFTKDELDALCRIYRKL--VSNCQYAAKTLASSSSSAAIAKPHAAVEGIDRIVFRELLHSTF 180
            ||.:|        .:||..|  |:|.|...::|.:.:.......|.|.|:             .|
  Fly    60 KKNQF--------YQIYLVLFNVANVQVIERSLLAITKDTKYVSPRAWVD-------------LF 103

  Fly   181 DIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDLNTDGFITKDE 245
            ::.|.|.| ||                                 |..|.|.|||....|.|.:::
  Fly   104 ELYTTEDL-ER---------------------------------RMKFAFEVYDTKNTGVIDREQ 134

  Fly   246 MFTLLRNCLIKQPQDEDPDEGVK---DLVEIVLKKFDLDKDGKVSLEDFMGTVTAEPLLIEAFGQ 307
            :...   |.....:.:|.||.::   |:.|.::||||:||||.:|.||:...|:.:|:|:|..|.
  Fly   135 VGVA---CEKFFHEGDDEDELIELRADMTEFIMKKFDVDKDGVISFEDYSSVVSQQPVLVEFLGW 196

  Fly   308 CLPTD 312
            ..|::
  Fly   197 LFPSN 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 24/66 (36%)
EF-hand_7 229..292 CDD:290234 23/65 (35%)
CG15177NP_649672.1 EF-hand_7 115..180 CDD:290234 23/67 (34%)
EFh 116..179 CDD:298682 22/65 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438939
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1834
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D106617at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.