DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and kcnip3b

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_957076.1 Gene:kcnip3b / 393755 ZFINID:ZDB-GENE-040426-1752 Length:259 Species:Danio rerio


Alignment Length:285 Identity:73/285 - (25%)
Similarity:116/285 - (40%) Gaps:62/285 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DGGATAGAGSGGGGGGG---GGGVAAAPTATGGTTGVGRSTLHANKTILK--TVSVFLASGKRNS 78
            |||....|....|...|   ..|....|..|             .|:::|  .|...:||.....
Zfish    10 DGGLLPDANGRDGDSSGQKESDGKWQKPRIT-------------RKSLMKCCLVKWIIASAAPQG 61

  Fly    79 SNQQSKAAAAALQNKRQQRQRRMDELSG-KVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQ 142
            ||..:.:..               |||. :..|:.|:.|:.:|:||:.||.:|   ||...:.| 
Zfish    62 SNDSTDSEL---------------ELSAVRHQPEGLEQLQAQTQFTRKELQSL---YRGFKNEC- 107

  Fly   143 YAAKTLASSSSSAAIAKPHAAVEGIDRIVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRL 207
                             |...|   |...|:.:....|...........:|.::|....| .:|.
Zfish   108 -----------------PSGLV---DEETFKSIYSQFFPQGDATTYAHFLFNAFDMDRNG-SIRF 151

  Fly   208 EGWLIGLSTFLRGTPAERAAFCFRVYDLNTDGFITKDEMFTLLRNCLIKQPQDEDP---DEGVKD 269
            |.::||||..|||:..|:..:.|.:||:|.||:|||:||..::::......:...|   |:...:
Zfish   152 EDFVIGLSVLLRGSVTEKLRWAFNLYDINKDGYITKEEMLAIMKSIYDMMGRYTSPCVKDDAAFE 216

  Fly   270 LVEIVLKKFDLDKDGKVSLEDFMGT 294
            .||...:|.|.::||.|:||:|:.|
Zfish   217 HVEKFFQKMDRNRDGVVTLEEFIET 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 22/66 (33%)
EF-hand_7 229..292 CDD:290234 22/65 (34%)
kcnip3bNP_957076.1 FRQ1 82..248 CDD:227455 53/185 (29%)
EF-hand_8 108..155 CDD:290545 10/50 (20%)
EFh 133..195 CDD:238008 24/62 (39%)
EFh 169..240 CDD:238008 23/70 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.