DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and guca1e

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_956950.1 Gene:guca1e / 393629 ZFINID:ZDB-GENE-040426-1577 Length:198 Species:Danio rerio


Alignment Length:212 Identity:46/212 - (21%)
Similarity:90/212 - (42%) Gaps:56/212 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 ELDALCRI---YRKLVSNCQ------------YAAKTLASSSSSAAIAKPHAAVEGIDRIVFREL 175
            ||.| |:.   |||.::.|.            :..|.|:..|::                 :...
Zfish    11 ELSA-CKCHQWYRKFMTECPSGQLTFYEFKKFFGLKNLSEKSNA-----------------YVNT 57

  Fly   176 LHSTFDIVTEEIL--MERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDLNTD 238
            :..||||..:..:  ||                   ::..||..|:|...::..:.|:::|::..
Zfish    58 MFKTFDIDDDGCIDFME-------------------YVAALSLVLKGGVQQKLRWYFKLFDMDGS 103

  Fly   239 GFITKDEMFTLLRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFMGTVTAEPLLIE 303
            |.|.|||:..:.:  .::.....:|:...:||.::|..|.|::.||::|||:||..::|:..:.|
Zfish   104 GCIDKDELLLIFK--AVQAINGAEPEISAEDLADMVFNKIDVNGDGELSLEEFMEGISADEKISE 166

  Fly   304 AFGQCLPTDSAVVSFFS 320
            ...|.|.....|.:.::
Zfish   167 MLTQSLDLTRIVSNIYN 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 18/63 (29%)
EF-hand_7 229..292 CDD:290234 18/62 (29%)
guca1eNP_956950.1 FRQ1 4..164 CDD:227455 42/191 (22%)
EF-hand_8 29..79 CDD:290545 9/85 (11%)
EFh 58..112 CDD:238008 17/72 (24%)
EFh 90..159 CDD:238008 20/70 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.