DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and CG3565

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster


Alignment Length:263 Identity:64/263 - (24%)
Similarity:108/263 - (41%) Gaps:81/263 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 MDELSGKVNP-----------KLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSS 154
            |.:|.|.::.           |.:..|.|.:.|:.:||.::..:|.|.|......||.:.....|
  Fly     1 MKDLDGSLDTLENARFNYVYMKDIARLAKDSIFSHNELISIVMLYHKFVLVNGPRAKYMTIQQLS 65

  Fly   155 AAIAKPHAAVEGIDRIVFRELLHSTFDIVTEEI---LMERI----------FCSWDKAHEGLPLR 206
            |.:                |||   |:||..::   ::.||          |.| || |    :.
  Fly    66 ALM----------------ELL---FEIVDRDLIATIVYRIAHTPGSRPPDFFS-DK-H----IH 105

  Fly   207 LEGWLIGLSTFLRGTPAERAAFCFRVYD------LNTD--GFITKDEMFTLLRNCLIKQPQDEDP 263
            ||.::...:.:.......:..|.|.|||      ||.:  ||.. .:.|           :.||.
  Fly   106 LESFVRLFTVYFTKDLQLKMEFAFSVYDKSDSKQLNGEQVGFFV-GKFF-----------ESEDE 158

  Fly   264 DEGVK---DLVEIVLKKFDLDKDGKVSLEDFMGTVTAEPLLIEAFGQCLPTD---------SAVV 316
            ||.::   |:.|::..|||||||..:.::::...|..:|:|:|.||:..|.:         :.|:
  Fly   159 DESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRRQPMLLECFGRVFPPNPQMEVLALCANVM 223

  Fly   317 SFF 319
            |:|
  Fly   224 SWF 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 23/74 (31%)
EF-hand_7 229..292 CDD:290234 22/73 (30%)
CG3565NP_611942.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438936
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D106617at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.