DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and Frq2

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001259675.1 Gene:Frq2 / 32799 FlyBaseID:FBgn0083228 Length:187 Species:Drosophila melanogaster


Alignment Length:210 Identity:55/210 - (26%)
Similarity:96/210 - (45%) Gaps:41/210 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 GKVNPKL----LDSLRKKTRFTKDELDALCRIYRK-LVSNCQYAAKTLASSSSSAAIAK---PHA 162
            ||.|.||    :|.|...|.||:.|:    |.:.| .:.:|   ...|.:......|.|   |..
  Fly     2 GKKNSKLKQDTIDRLTTDTYFTEKEI----RQWHKGFLKDC---PNGLLTEQGFIKIYKQFFPDG 59

  Fly   163 AVEGIDRIVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAA 227
            .......:||                  |:|   |:.::| .:..|.::..||...||...|:..
  Fly    60 DPSKFASLVF------------------RVF---DENNDG-AIEFEEFIRALSITSRGNLDEKLH 102

  Fly   228 FCFRVYDLNTDGFITKDEMFTL---LRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLE 289
            :.||:||::.||:||::||:.:   :...:.:|||.||.:...| .|:.:..:.|.:.|.:::||
  Fly   103 WAFRLYDVDNDGYITREEMYNIVDAIYQMVGQQPQTEDENTPQK-RVDKIFDQMDKNHDDRLTLE 166

  Fly   290 DFMGTVTAEPLLIEA 304
            :|.....|:|.:::|
  Fly   167 EFREGSKADPRIVQA 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 21/66 (32%)
EF-hand_7 229..292 CDD:290234 21/65 (32%)
Frq2NP_001259675.1 FRQ1 9..178 CDD:227455 49/198 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442302
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
54.840

Return to query results.
Submit another query.