DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and KCNIP1

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001265268.1 Gene:KCNIP1 / 30820 HGNCID:15521 Length:241 Species:Homo sapiens


Alignment Length:217 Identity:59/217 - (27%)
Similarity:103/217 - (47%) Gaps:16/217 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 AALQNK--RQQRQRRMDELSGKV---NPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKT 147
            ::||.|  |..:.:..|||...:   .|:.|:.|..:|.|||.||..|   ||...:.|......
Human     9 SSLQTKQRRPSKDKIEDELEMTMVCHRPEGLEQLEAQTNFTKRELQVL---YRGFKNECPSGVVN 70

  Fly   148 LASSSSSAAIAKPHAAVEGIDRIVFRELLHST----FDIVTEEILMERIFCSWDKAHEGLPLRLE 208
            ..:.....|...||.|:..::.....|.|..:    |.:|........:|.::|....| .::.|
Human    71 EDTFKQIYAQFFPHGALPCLEGSPCVEFLPPSPALLFCLVDASTYAHYLFNAFDTTQTG-SVKFE 134

  Fly   209 GWLIGLSTFLRGTPAERAAFCFRVYDLNTDGFITKDEMFTLLR---NCLIKQPQDEDPDEGVKDL 270
            .::..||..||||..|:..:.|.:||:|.||:|.|:||..:::   :.:.|.......::..:..
Human   135 DFVTALSILLRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQH 199

  Fly   271 VEIVLKKFDLDKDGKVSLEDFM 292
            |::..:|.|.:|||.|:|::|:
Human   200 VDVFFQKMDKNKDGIVTLDEFL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 19/66 (29%)
EF-hand_7 229..292 CDD:290234 19/65 (29%)
KCNIP1NP_001265268.1 FRQ1 39..230 CDD:227455 51/187 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.