DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and KCNIP2

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_055406.2 Gene:KCNIP2 / 30819 HGNCID:15522 Length:285 Species:Homo sapiens


Alignment Length:307 Identity:80/307 - (26%)
Similarity:131/307 - (42%) Gaps:65/307 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GKGRSPTPTPNRDGGATAGAGSGGGGGGGGGGV---------AAAPTATGGTTGVGRSTLHANKT 62
            |:||..:.:.:||...:....:|...|.....:         ...|.|....:.:||        
Human     3 GQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSEIGR-------- 59

  Fly    63 ILKTVSVFLASGKRNSSNQQSKAAAAALQNKRQQRQRRMD--------ELSGKVN-PKLLDSLRK 118
                  ||...|  :||...:.||.|:|   |..|.|.:|        |||...: |:.|:.|::
Human    60 ------VFRFLG--DSSLPSALAAPASL---RPHRPRLLDPDSVDDEFELSTVCHRPEGLEQLQE 113

  Fly   119 KTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDRIVFRELLHSTFDIV 183
            :|:||:.||..|   ||...:.|                  |...|...:   |:::....|...
Human   114 QTKFTRKELQVL---YRGFKNEC------------------PSGIVNEEN---FKQIYSQFFPQG 154

  Fly   184 TEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDLNTDGFITKDEMFT 248
            ........:|.::|..|:| .:..|.::.|||..||||..:|..:.|.:||||.||.|||:||..
Human   155 DSSTYATFLFNAFDTNHDG-SVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLD 218

  Fly   249 LLRNCLIKQPQDEDP---DEGVKDLVEIVLKKFDLDKDGKVSLEDFM 292
            ::::......:...|   :|..::.||...:|.|.:|||.|::|:|:
Human   219 IMKSIYDMMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 23/66 (35%)
EF-hand_7 229..292 CDD:290234 23/65 (35%)
KCNIP2NP_055406.2 FRQ1 108..274 CDD:227455 52/183 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.