DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and GUCA1A

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001371839.1 Gene:GUCA1A / 2978 HGNCID:4678 Length:201 Species:Homo sapiens


Alignment Length:190 Identity:39/190 - (20%)
Similarity:79/190 - (41%) Gaps:51/190 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 YRKLVSNCQ------------YAAKTLASSSSSAAIAKPHAAVEGIDRIVFRELLHSTFDIVTEE 186
            |:|.::.|.            :..|.|:.|:|.                 :.|.:..|||...:.
Human    22 YKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQ-----------------YVEQMFETFDFNKDG 69

  Fly   187 IL--MERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDLNTDGFITKDEMFTL 249
            .:  ||                   ::..||..|:|...::..:.|::||::.:|.|.:||:.|:
Human    70 YIDFME-------------------YVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTI 115

  Fly   250 LRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFMGTVTAEPLLIEAFGQCL 309
            ::......| ..|.....::..:.|..|.|::.||::|||:|:..|..:.:|::...:.|
Human   116 IQAIRAINP-CSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 18/63 (29%)
EF-hand_7 229..292 CDD:290234 18/62 (29%)
GUCA1ANP_001371839.1 FRQ1 12..163 CDD:227455 37/177 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.