DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and Kcnip4

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_852030.1 Gene:Kcnip4 / 259243 RGDID:708539 Length:250 Species:Rattus norvegicus


Alignment Length:220 Identity:59/220 - (26%)
Similarity:101/220 - (45%) Gaps:45/220 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SKAAAAALQNKRQQRQRRMDEL---SGKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYA 144
            :|.::.|:||..:      |||   :.:..|:.|:.|..:::|||.||..|   ||...:.|   
  Rat    46 AKTSSPAIQNSVE------DELEMATVRHRPEALELLEAQSKFTKKELQIL---YRGFKNEC--- 98

  Fly   145 AKTLASSSSSAAIAKPHAAVEGIDRIVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEG 209
                           |...|   :...|:|:....|...........:|.::|..|.| .:..|.
  Rat    99 ---------------PSGVV---NEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNG-AVSFED 144

  Fly   210 WLIGLSTFLRGTPAERAAFCFRVYDLNTDGFITKDEMFTLLR-------NCLIKQPQDEDPDEGV 267
            ::.|||..||||..|:..:.|.:||:|.||:|||:||..:::       .|.....:::.|    
  Rat   145 FIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAP---- 205

  Fly   268 KDLVEIVLKKFDLDKDGKVSLEDFM 292
            :..||...:|.|.:|||.|::::|:
  Rat   206 RQHVETFFQKMDKNKDGVVTIDEFI 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 21/70 (30%)
EF-hand_7 229..292 CDD:290234 21/69 (30%)
Kcnip4NP_852030.1 KIS. /evidence=ECO:0000250 2..44
FRQ1 80..239 CDD:227455 49/180 (27%)
Interaction with KCND2. /evidence=ECO:0000250 237..250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.