DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and Rcvrn

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_033064.1 Gene:Rcvrn / 19674 MGIID:97883 Length:202 Species:Mus musculus


Alignment Length:204 Identity:46/204 - (22%)
Similarity:91/204 - (44%) Gaps:33/204 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SGKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDR 169
            ||.::.::|:.|:..|:||::||.|.   |:..:..|....                     |.|
Mouse     6 SGALSKEILEELQLNTKFTEEELSAW---YQSFLKECPSGR---------------------ITR 46

  Fly   170 IVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYD 234
            ..|..:....|.....:...:.:|.|:|...:| .|..:.::|.|.....|.|.::..:.|.:||
Mouse    47 QEFESIYSKFFPDSDPKAYAQHVFRSFDANSDG-TLDFKEYVIALHMTTAGKPTQKLEWAFSLYD 110

  Fly   235 LNTDGFITKDEMFTLLRNCLIKQPQDED----PDE--GVKDLVEIVLKKFDLDKDGKVSLEDFM- 292
            ::.:|.|:|:|:..::. .:.|..:.||    ||:  ..:...|.:...|...:|.|::.|:|: 
Mouse   111 VDGNGTISKNEVLEIVM-AIFKMIKPEDVKLLPDDENTPEKRAEKIWAFFGKKEDDKLTEEEFIE 174

  Fly   293 GTVTAEPLL 301
            ||:..:.:|
Mouse   175 GTLANKEIL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 17/69 (25%)
EF-hand_7 229..292 CDD:290234 17/68 (25%)
RcvrnNP_033064.1 FRQ1 14..182 CDD:227455 43/193 (22%)
EFh <37..90 CDD:298682 11/74 (15%)
EFh 65..127 CDD:238008 16/62 (26%)
EFh 101..175 CDD:238008 18/74 (24%)
Interaction with GRK1. /evidence=ECO:0000250|UniProtKB:P21457 189..192
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.