DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and ncs-7

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001360662.1 Gene:ncs-7 / 182694 WormBaseID:WBGene00015867 Length:239 Species:Caenorhabditis elegans


Alignment Length:233 Identity:52/233 - (22%)
Similarity:97/233 - (41%) Gaps:39/233 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 AAAALQNK--RQQRQRRMDELSG--KVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAK 146
            ||..:..|  |.:.:..:|....  :..|..:|.|.:.|.|:|.|:..|.|.:::|         
 Worm    25 AALFISGKTGRAEMEEELDTQPAIERQTPPSIDYLIEITNFSKREIQQLYRSFKEL--------- 80

  Fly   147 TLASSSSSAAIAKPHAAVEGIDRIVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWL 211
                           ..:..:|...|:.:..|.|.....:...|.:|.:.|:...|....|: ::
 Worm    81 ---------------WPIGTVDLEQFQLIYASIFPNGDSKGYAELVFKNIDQNRVGTVTFLD-FI 129

  Fly   212 IGLSTFLRGTPAERAAFCFRVYDLNTDGFITKDEMFTLLRNCLIKQPQDEDPDEGV-----KDLV 271
            ...|...:||..||..:.|.:||.|..||:..:|:|.::::  :.|..|......|     :..|
 Worm   130 TNYSKIAKGTLDERLDWIFTLYDTNRCGFLAYNEIFHVVKS--MYQMMDSSLKPAVLATICRQHV 192

  Fly   272 EIVLKKFDLDKDGKVSLEDFMGTVTAEPLLI---EAFG 306
            :||.|..::..:||||..:|:....::..::   |.||
 Worm   193 KIVFKNLNIANNGKVSKAEFLQRCRSDSDILASMELFG 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 19/68 (28%)
EF-hand_7 229..292 CDD:290234 19/67 (28%)
ncs-7NP_001360662.1 FRQ1 59..222 CDD:227455 42/189 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107931
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.