DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and ncs-1

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_508186.1 Gene:ncs-1 / 180448 WormBaseID:WBGene00003563 Length:191 Species:Caenorhabditis elegans


Alignment Length:209 Identity:49/209 - (23%)
Similarity:93/209 - (44%) Gaps:38/209 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 GKVNPKLLDS----LRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEG 166
            ||.|.||..|    |.::|.||:.|:.   :.|:..|.:|.....|.|.                
 Worm     2 GKGNSKLKSSQIRDLAEQTYFTEKEIK---QWYKGFVRDCPNGMLTEAG---------------- 47

  Fly   167 IDRIVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFR 231
                 |:::....|...........:|..:|:..:| .:....::..||...||...|:..:.|:
 Worm    48 -----FQKIYKQFFPQGDPSDFASFVFKVFDENKDG-AIEFHEFIRALSITSRGNLDEKLHWAFK 106

  Fly   232 VYDLNTDGFITKDEMFTLLRNCL------IKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLED 290
            :|||:.|||||::||.:::.:..      ::.|::|:..|   ..|:.:.:..|.:.|.:::||:
 Worm   107 LYDLDQDGFITRNEMLSIVDSIYKMVGSSVQLPEEENTPE---KRVDRIFRMMDKNNDAQLTLEE 168

  Fly   291 FMGTVTAEPLLIEA 304
            |.....|:|.::.|
 Worm   169 FKEGAKADPSIVHA 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 19/69 (28%)
EF-hand_7 229..292 CDD:290234 19/68 (28%)
ncs-1NP_508186.1 FRQ1 11..179 CDD:227455 43/195 (22%)
EFh 67..125 CDD:238008 19/58 (33%)
EFh 100..174 CDD:238008 20/76 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.