DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and ncs-6

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_494569.1 Gene:ncs-6 / 173700 WormBaseID:WBGene00021116 Length:338 Species:Caenorhabditis elegans


Alignment Length:237 Identity:43/237 - (18%)
Similarity:83/237 - (35%) Gaps:73/237 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 DELSG------KVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYA--------AKTLASSS 152
            |||..      ...|..||.|.:.|.|.:..:..:.|.:::..||.:..        ......::
 Worm    73 DELEDASANPFNTQPPGLDQLVQLTGFNRKWIMFMYRNFKQKCSNGRMTDSQWRILFRSIFPQAN 137

  Fly   153 SSAAIAKPHAAV---EGIDRIVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGL 214
            .||.|.:.:||:   :...:|.|.:|                |.|.|:.:.:|....:..:.|..
 Worm   138 DSAFIDRLYAAIVKKKQHPQITFEDL----------------ILCLWELSEDGKTSEMGNYHINS 186

  Fly   215 STFLRGTPAERAAFCFRVYDLNTDGFITKDEMFTLLRNCL-----IKQP---------------- 258
            |.        ||.|.|::.|....|.:.:...:...| |:     :.:|                
 Worm   187 SA--------RAQFAFQLMDEEGKGRVDEPGFYKYTR-CVFALTAVNKPCTDQIIDASTIGLPAS 242

  Fly   259 ---QDEDPDEGVKDLVEIV-------LKKFDLDKDGKVSLED 290
               :....|:.:|.:..::       .|:.|.|:||.:::.|
 Worm   243 SIYRSTSVDDVLKPMSPLIARFSSKRFKELDTDRDGFITVRD 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 15/94 (16%)
EF-hand_7 229..292 CDD:290234 14/93 (15%)
ncs-6NP_494569.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.