DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and Rcvrn

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_543177.2 Gene:Rcvrn / 140936 RGDID:620258 Length:202 Species:Rattus norvegicus


Alignment Length:206 Identity:47/206 - (22%)
Similarity:91/206 - (44%) Gaps:37/206 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SGKVNPKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDR 169
            ||.::.::|:.|:..|:||::||.|.   |:..:..|....                     |.|
  Rat     6 SGALSKEILEELQLNTKFTEEELSAW---YQSFLKECPSGR---------------------ITR 46

  Fly   170 IVFRELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYD 234
            ..|..:....|.....:...:.:|.|:|...:| .|..:.::|.|.....|.|.::..:.|.:||
  Rat    47 QEFESIYSKFFPDSDPKAYAQHVFRSFDANSDG-TLDFKEYVIALHMTTAGKPTQKLEWAFSLYD 110

  Fly   235 LNTDGFITKDE-------MFTLLRNCLIKQ-PQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDF 291
            ::.:|.|:|:|       :|.:::...:|. |.||:..|...:.:.....|.|   |.|::.|:|
  Rat   111 VDGNGTISKNEVLEIVMAIFKMIKPEDVKNLPDDENTPEKRAEKIWAFFGKKD---DDKLTEEEF 172

  Fly   292 M-GTVTAEPLL 301
            : ||:..:.:|
  Rat   173 IEGTLANKEIL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 18/71 (25%)
EF-hand_7 229..292 CDD:290234 18/70 (26%)
RcvrnNP_543177.2 FRQ1 14..182 CDD:227455 44/195 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.