DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and guca1a

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_571945.1 Gene:guca1a / 140430 ZFINID:ZDB-GENE-011128-5 Length:189 Species:Danio rerio


Alignment Length:192 Identity:38/192 - (19%)
Similarity:84/192 - (43%) Gaps:25/192 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 TRFTKDELDA--LCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDRIVFRELLHSTFDI 182
            |..|.|:|.|  :...|:|.::.|.....||..       .|....:.|:|              
Zfish     5 TGSTVDDLQAVEMHLWYKKFMTECPSGQLTLHE-------FKQFFGLRGLD-------------- 48

  Fly   183 VTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDLNTDGFITKDEMF 247
            ......:|::|.::|...:|....:| ::..||..:||....:..:.|::||::.:|.|.:.|:.
Zfish    49 PKANAYIEQMFRTFDMNKDGYIDFME-YVAALSLVMRGKMEHKLRWYFKLYDVDGNGCIDRYELL 112

  Fly   248 TLLRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFMGTVTAEPLLIEAFGQCL 309
            .::: .:......|..:...::....|.::.|::.||::||::|:....::...:|...:.|
Zfish   113 NIIK-AIRAINGSETQESSAEEFTNRVFERIDINGDGELSLDEFVAGARSDEEFMEVMMKSL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 13/63 (21%)
EF-hand_7 229..292 CDD:290234 13/62 (21%)
guca1aNP_571945.1 EFh <27..76 CDD:298682 11/70 (16%)
EFh 54..116 CDD:238008 15/62 (24%)
EF-hand_7 55..115 CDD:290234 15/60 (25%)
EFh 90..160 CDD:238008 14/70 (20%)
EF-hand_7 91..157 CDD:290234 14/66 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.