DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and kcnip4b

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_003197705.2 Gene:kcnip4b / 100534855 ZFINID:ZDB-GENE-090313-35 Length:225 Species:Danio rerio


Alignment Length:237 Identity:52/237 - (21%)
Similarity:105/237 - (44%) Gaps:44/237 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LASGKRNSSNQQSKAAAAALQNKRQQRQRRMDELSGKVNPKLLDSLRKKTRFTKDELDALCRIYR 135
            |.:|..|:.|:..:                .:..:.:.:|:.|:.|:.:|.|::.||..|   ||
Zfish    22 LITGTLNTDNEDEE----------------QESTTERYHPENLEQLQSQTHFSRQELQLL---YR 67

  Fly   136 KLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDRIVFRELLHSTFDIVTEEILMERIFCSWDKAH 200
            ...::|                  |...|   :...|:.:....|.:.......:.:|.::||..
Zfish    68 GFKNDC------------------PSGVV---NEDTFKNIYALFFPLGDSSKYAQFLFNAFDKDK 111

  Fly   201 EGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDLNTDGFITKDEMFTLLRNCLIKQPQDEDP-- 263
            .| .|..|..:..||..||||..|:..:.|.:||:|.||.|||:||..::::......:...|  
Zfish   112 NG-SLSFEELVCDLSVLLRGTTEEKLNWAFNLYDINKDGQITKEEMLDIMKSIYDLMGKSIHPRL 175

  Fly   264 -DEGVKDLVEIVLKKFDLDKDGKVSLEDFMGTVTAEPLLIEA 304
             :|.|:..|.:..:..|:::||.|::::|:.:...:..::::
Zfish   176 KEEAVRQHVRMFFQNMDINQDGVVTIDEFIDSCEKDEHIMQS 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 19/66 (29%)
EF-hand_7 229..292 CDD:290234 19/65 (29%)
kcnip4bXP_003197705.2 FRQ1 48..214 CDD:227455 47/190 (25%)
EF-hand_8 74..121 CDD:290545 10/50 (20%)
EFh 99..161 CDD:238008 24/62 (39%)
EFh 135..206 CDD:238008 20/70 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0044
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.