DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and kcnip1

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_002937770.1 Gene:kcnip1 / 100497014 XenbaseID:XB-GENE-973728 Length:230 Species:Xenopus tropicalis


Alignment Length:225 Identity:56/225 - (24%)
Similarity:98/225 - (43%) Gaps:28/225 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 LASGKRNSSNQQSKAAAAALQNKRQQRQRRMDELSGKVNPKLLDSLRKKTRFTKDELDALCRIYR 135
            |.:.:|..|..|........|||..:.:..::..:....|:.|:.|..:|.|.|.||..|   ||
 Frog    11 LQTKQRRPSKGQLYVMDYIPQNKSDKVEDELEMTTVCYRPEGLEQLEAQTNFNKRELQVL---YR 72

  Fly   136 KLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDRIVFRELLHSTFDIVTEEILMERIFCSWDKAH 200
            ...:.|                  |...|   :...|:.:....|......:....:|.::|.|.
 Frog    73 GFKNEC------------------PSGVV---NEDTFKLIYSQFFPHGDASMYAHYLFNAFDAAQ 116

  Fly   201 EGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDLNTDGFITKDEMFTLLR---NCLIKQPQDED 262
            .| .::.|.::..||..|||:..|:..:.|.:||:|.||.|.|:||..:::   :.:.|......
 Frog   117 SG-SVKFEDFVAALSVLLRGSIHEKLRWTFNLYDINKDGNINKEEMMDIVKAIYDMMGKYTYPVL 180

  Fly   263 PDEGVKDLVEIVLKKFDLDKDGKVSLEDFM 292
            .::..|..||:..:|.|.:|||.|:|::|:
 Frog   181 KEDAPKQHVEVFFQKMDKNKDGVVTLDEFI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 21/66 (32%)
EF-hand_7 229..292 CDD:290234 21/65 (32%)
kcnip1XP_002937770.1 FRQ1 53..219 CDD:227455 48/183 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.