DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and si:ch211-103a14.5

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_002666176.1 Gene:si:ch211-103a14.5 / 100330921 ZFINID:ZDB-GENE-091204-414 Length:192 Species:Danio rerio


Alignment Length:215 Identity:41/215 - (19%)
Similarity:86/215 - (40%) Gaps:56/215 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 DELDALC---RIYRKLVSNCQ------------YAAKTLASSSSSAAIAKPHAAVEGIDRIVFRE 174
            :||.| |   :.|||.::.|.            :..|.|:..|:...:.                
Zfish    10 EELSA-CESHQWYRKFMTECPSGQLTFYEFKKFFGLKNLSEKSNEYVMT---------------- 57

  Fly   175 LLHSTFDIVTEEIL--MERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDLNT 237
             :..|||:..:..:  ||                   ::..||..|:|...::..:.|::||::.
Zfish    58 -MFQTFDMNDDGCIDFME-------------------YVAALSLILKGGVQQKLRWYFKLYDVDG 102

  Fly   238 DGFITKDEMFTLLRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFMGTVTAEPLLI 302
            .|.|.::|:..:::  .|:.....:.:...::...:|.:|.||:.||.:::::||..:.|:..|.
Zfish   103 SGCIDREELLLIVK--AIRAINGVEQEVSAEEFTNMVFEKIDLNADGVLTMDEFMEGIQADEYLS 165

  Fly   303 EAFGQCLPTDSAVVSFFSTL 322
            ....|.|.....|...:|.:
Zfish   166 TMLTQSLDLTHIVKKIYSEI 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 13/63 (21%)
EF-hand_7 229..292 CDD:290234 13/62 (21%)
si:ch211-103a14.5XP_002666176.1 EF-hand_8 29..79 CDD:290545 8/85 (9%)
EF-hand_7 55..112 CDD:290234 15/92 (16%)
EFh 58..116 CDD:238008 15/76 (20%)
EFh 90..159 CDD:238008 15/70 (21%)
EF-hand_7 91..158 CDD:290234 15/68 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.