DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and kcnip1a

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_021326489.1 Gene:kcnip1a / 100008068 ZFINID:ZDB-GENE-080721-17 Length:230 Species:Danio rerio


Alignment Length:192 Identity:49/192 - (25%)
Similarity:86/192 - (44%) Gaps:28/192 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDRIVFRE 174
            |:.|:.|..:|.|.|.||..|   ||...:.|                  |...|   :...|::
Zfish    50 PEGLEQLEAQTNFNKKELQVL---YRGFKNEC------------------PSGVV---NEETFKQ 90

  Fly   175 LLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDLNTDG 239
            :....|...........:|.::|.:|.| .::.|.::..||..||||..|:..:.|.:||:|.||
Zfish    91 IYSQFFPHGDASTYAHYLFNAFDSSHNG-SIKFEDFVTALSILLRGTTTEKLEWTFNLYDINRDG 154

  Fly   240 FITKDEMFTLLRNCLIKQPQDEDP---DEGVKDLVEIVLKKFDLDKDGKVSLEDFMGTVTAE 298
            :|.|:||..:::.......:...|   .:..|..|:...:|.|.::||.|:|::|:.:.|.:
Zfish   155 YINKEEMMDIVKAIYDMMGRFTYPALKTDTPKQHVDAFFQKMDKNRDGVVTLDEFIVSCTED 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 19/66 (29%)
EF-hand_7 229..292 CDD:290234 19/65 (29%)
kcnip1aXP_021326489.1 FRQ1 53..219 CDD:227455 48/189 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.