DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2256 and kcnip2

DIOPT Version :9

Sequence 1:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_003201187.1 Gene:kcnip2 / 100003947 ZFINID:ZDB-GENE-081031-91 Length:253 Species:Danio rerio


Alignment Length:269 Identity:63/269 - (23%)
Similarity:109/269 - (40%) Gaps:67/269 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 FLASGKRNSSNQQSKAAAAALQNKRQQRQR----------------RMDELSGK-------VNPK 111
            |..||:.:.||........:.|.|:..:||                |.:.:...       ..|.
Zfish    10 FNTSGECDGSNDLLTGNPPSGQRKKNMKQRFLKLLPCCHVDSTPAVRQNSIEEDFELATVCYRPD 74

  Fly   112 LLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDRIVFRELL 176
            .||.|.:.|:|||.||..|   ||...::|                  |...|.           
Zfish    75 SLDKLMELTKFTKTELQIL---YRSFKNDC------------------PTGVVN----------- 107

  Fly   177 HSTFDIVTEEIL--------MERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVY 233
            ..||.::.....        ...:|.::|:...| .:..|.:::|||..||||..:|.::.|.:|
Zfish   108 EETFQLIYSHFFPHGDSSAYAHFLFEAFDRRKNG-AVNFEDFVVGLSIILRGTVTDRLSWAFSLY 171

  Fly   234 DLNTDGFITKDEMFTLLRNCLIKQPQDEDP---DEGVKDLVEIVLKKFDLDKDGKVSLEDFMGTV 295
            |||.||.|||:||..::::......::..|   |...::.||...:|.|.:.||.:::|:|:.:.
Zfish   172 DLNKDGCITKEEMNDIMKSIYDMMGKNTCPCMNDSAPREHVESFFQKMDRNNDGVITMEEFLESC 236

  Fly   296 TAEPLLIEA 304
            ..:..::|:
Zfish   237 QKDEAIMES 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2256NP_572437.2 EFh 228..292 CDD:238008 21/66 (32%)
EF-hand_7 229..292 CDD:290234 21/65 (32%)
kcnip2XP_003201187.1 FRQ1 72..242 CDD:227455 52/202 (26%)
EFh 127..189 CDD:238008 24/62 (39%)
EFh 163..234 CDD:238008 23/70 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.