DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and Rdh10

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_598593.1 Gene:Rdh10 / 98711 MGIID:1924238 Length:341 Species:Mus musculus


Alignment Length:257 Identity:90/257 - (35%)
Similarity:137/257 - (53%) Gaps:28/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LVVDIVMLIVK-FWLAIAEAIVGLFRAPPLDDVNGKVVLITGTGHGMGKEMALQYAKLGATILCW 88
            :||:..::..| .|..:..|...|.| |....|.|:|.||||.|.|:|:..||::|:..|.::.|
Mouse     3 IVVEFFVVTFKVLWAFVLAAARWLVR-PKEKSVAGQVCLITGAGSGLGRLFALEFARRRALLVLW 66

  Fly    89 DVNEQTNNQTVKEIKN-------------NGGK------------AFGYVCNVTKREELIELAQK 128
            |:|.|:|.:|...:::             ..||            .|.|.|:|.|||.:...|::
Mouse    67 DINTQSNEETAGMVRHIYRDLEAADAAALQAGKGEEEILPPCNLQVFTYTCDVGKRENVYLTAER 131

  Fly   129 VRKEHGFIHVVVNNAGIMPCHPLLEHTENEIRLMYEINVLSHFWIIQAFLPDMIERNEGSIVALS 193
            ||||.|.:.|:|||||::..|.|||..:..|.....:|..:|||..:||||.|:|.|.|.||.::
Mouse   132 VRKEVGEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVA 196

  Fly   194 SCAGLFGLINLVPYCGTKFAVRGYMAALVEELRQKNPQNNVKLTTIYPYMIDTGLCKNPRYR 255
            |..|||....:..||.:||.|.|:..:|..||:... ::.:|.|.:.||::|||:.:..|.|
Mouse   197 SSLGLFSTAGVEDYCASKFGVVGFHESLSHELKAAE-KDGIKTTLVCPYLVDTGMFRGCRIR 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 77/213 (36%)
NADB_Rossmann 60..287 CDD:304358 80/221 (36%)
Rdh10NP_598593.1 adh_short 37..252 CDD:278532 78/215 (36%)
17beta-HSDXI-like_SDR_c 38..307 CDD:187598 80/221 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.