DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and SDR2

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_190736.1 Gene:SDR2 / 824331 AraportID:AT3G51680 Length:303 Species:Arabidopsis thaliana


Alignment Length:204 Identity:51/204 - (25%)
Similarity:96/204 - (47%) Gaps:13/204 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VNGKVVLITGTGHGMGKEMALQYAKLGATILCWDVNEQTNNQTVKEI---KNNGGKAFGYVCNVT 117
            :.|||.:|||..||:||...:.:|:.|||::..||:....:...|.:   |.:...|| ..|:|:
plant    32 LEGKVAIITGGAHGIGKATVMLFARHGATVVIADVDNVAGSSLAKSLSSHKTSPMVAF-ISCDVS 95

  Fly   118 KREELIELAQKVRKEHGFIHVVVNNAGIM----PCHPLLEHTENEIRLMYEINVLSHFWIIQAFL 178
            ...::..|.......:|.:.::.||||::    ....:|:...:|...:..:||......::...
plant    96 VEADVENLVNVTVARYGRLDILFNNAGVLGDQKKHKSILDFDADEFDHVMRVNVRGVGLGMKHGA 160

  Fly   179 PDMIERN-EGSIVALSSCAGLFGLINLVPYCGTKFAVRGYMAALVEELRQKNPQNNVKLTTIYPY 242
            ..||:|. :|.|::.:|.||:.|.:....|..:|.|:.|.......||    .:..:::..|.|:
plant   161 RAMIKRGFKGCIISTASVAGVMGGMGPHAYTASKHAIVGLTKNAACEL----GKYGIRVNCISPF 221

  Fly   243 MIDTGLCKN 251
            .:.|.:..|
plant   222 GVATSMLVN 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 49/196 (25%)
NADB_Rossmann 60..287 CDD:304358 49/200 (25%)
SDR2NP_190736.1 PLN02253 23..296 CDD:177895 51/204 (25%)
NADB_Rossmann 31..295 CDD:304358 51/204 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.