DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and SDR3

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_182235.1 Gene:SDR3 / 819326 AraportID:AT2G47130 Length:257 Species:Arabidopsis thaliana


Alignment Length:244 Identity:60/244 - (24%)
Similarity:110/244 - (45%) Gaps:20/244 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 VNGKVVLITGTGHGMGKEMALQYAKLGATILCWDVNEQTNNQTVKEIKNNGGKAFGYVCNVTKRE 120
            ::||:.:|||...|:|.|....:...||.::..|..|:........:..:  ||..|.|:||..:
plant     6 LDGKIAIITGGASGIGAEAVRLFTDHGAKVVIVDFQEELGQNVAVSVGKD--KASFYRCDVTNEK 68

  Fly   121 ELIELAQKVRKEHGFIHVVVNNAGIM--PCHPLLEHTENEIRLMYEINVLSHFWIIQAFLPDMIE 183
            |:....:...:::|.:.|:.:|||:|  |...|..:.|...|.| .:||......|:.....|:|
plant    69 EVENAVKFTVEKYGKLDVLFSNAGVMEQPGSFLDLNLEQFDRTM-AVNVRGAAAFIKHAARAMVE 132

  Fly   184 R-NEGSIVALSSCAGLFGLINLVPYCGTKFAVRGYMAALVEELRQKNPQNNVKLTTIYPYMIDTG 247
            : ..||||..:|.|...|......|..:|.|:.|    ||:.......:..:::..:.||.:.|.
plant   133 KGTRGSIVCTTSVASEIGGPGPHAYTASKHALLG----LVKSACGGLGKYGIRVNGVAPYAVATA 193

  Fly   248 LCKNPRYRFPNLFKLIPADVAAGSIIEA---QRQGLEEAAIPRHFVAAE 293
            :    ..|.....:::....||..|::.   :.:.:.|||:   |:|::
plant   194 I----NSRDEETVRMVEEYSAATGILKGVVLKARHVAEAAL---FLASD 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 50/191 (26%)
NADB_Rossmann 60..287 CDD:304358 56/232 (24%)
SDR3NP_182235.1 PLN02253 1..254 CDD:177895 60/244 (25%)
NADB_Rossmann 5..252 CDD:304358 60/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.