DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and AT2G17845

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_565425.1 Gene:AT2G17845 / 816294 AraportID:AT2G17845 Length:312 Species:Arabidopsis thaliana


Alignment Length:187 Identity:47/187 - (25%)
Similarity:81/187 - (43%) Gaps:51/187 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IAEAIVGLFRAPPLDDVNGKVVLITGTGHGMGKEMALQYAKLGATI------------LCWDVNE 92
            :.|.::.|:....|.|   ||||:||...|:|:|:.|..||.|..|            ||.::|.
plant    34 VREILLLLYLTCELKD---KVVLVTGASSGIGREVCLDLAKAGCKIIAAARRVDRLKSLCSEINR 95

  Fly    93 QTNNQTVKEIKNNGGKAFGYVCNVTKREELIEL--------AQKVRKE----HGFIHVVVNNAGI 145
                             |.|...:  :.|.:||        .||..|:    .|.|..::||||.
plant    96 -----------------FEYSAGI--QAEALELDVSSDAATVQKAVKKAWEIFGKIDALINNAGF 141

  Fly   146 M-PCHPLLEHTENEIRLMYEINVLSHFWIIQAFLPDMI---ERNEGSIVALSSCAGL 198
            . .....|:.:|:|...:::.| |:..|::..::..::   :|..||::.:||.:.|
plant   142 RGNVKSSLDLSEDEWDKVFKTN-LTGTWLVSKYVCILMRDAKRGGGSVINISSVSWL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 43/168 (26%)
NADB_Rossmann 60..287 CDD:304358 42/167 (25%)
AT2G17845NP_565425.1 fabG 47..303 CDD:235546 45/174 (26%)
SDR_c 52..298 CDD:212491 41/166 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.