DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and si:dkey-221h15.4

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:NP_001373167.1 Gene:si:dkey-221h15.4 / 563950 ZFINID:ZDB-GENE-041014-340 Length:350 Species:Danio rerio


Alignment Length:296 Identity:86/296 - (29%)
Similarity:152/296 - (51%) Gaps:10/296 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VVDIVMLIVKFWLAIAEAIVGLFRAPPLDDVNGKVVLITGTGHGMGKEMALQYAKLGATILCWDV 90
            :.||..||:.......||.|..|......||.|::||:||..:|:||.:|.:....|||::.||:
Zfish    13 IKDIFELILGAVFYFFEAFVRFFIPRSKKDVEGEIVLVTGAANGIGKLIAKELGHYGATLVLWDI 77

  Fly    91 NEQTNNQTVKEIKN-NGGKAFGYVCNVTKREELIELAQKVRKEHGFIHVVVNNAGIMP-CHPLLE 153
            |.:...:|.||:|. ...:.:.|.|:.::|.|:..:|:.|::|.|.:.::|||||::. .:..||
Zfish    78 NSEALEKTAKELKQVLDVRVYAYTCDCSRRSEVYRVAEVVKREVGDVSILVNNAGMVSGKYTFLE 142

  Fly   154 HTENEIRLMYEINVLSHFWIIQAFLPDMIERNEGSIVALSSCAGLFGLINLVPYCGTKFAVRGYM 218
            ..::.:.....:|..:|||..:||||.|:|::.|.::.::....||.:..|..||.:|.|...:.
Zfish   143 APDSLVDRTLRVNAAAHFWTYKAFLPAMLEQDHGHLLCVACHGALFAMNGLADYCASKSAAVRFA 207

  Fly   219 AALVEELRQKNPQNNVKLTTIYPYMIDT---GLCKNPRYRFPNLFKLIPADVAAGSIIEAQRQGL 280
            .::..||.... :..:|.|.:.||:|:|   |.|:..|   |....::....||..|::|..|..
Zfish   208 ESIALELLVLK-KEGIKTTIVCPYLINTNMFGGCQTKR---PFFLPVLEQRYAAKQIVDAILQEK 268

  Fly   281 EEAAIPRHFVAAEKIGRLIPRKAMRLVNDFFDTGVD 316
            ....:|........:..::|.|...:..:||. |:|
Zfish   269 MYLLLPSSLSLLMALKSVMPAKLGIIFVNFFG-GMD 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 59/193 (31%)
NADB_Rossmann 60..287 CDD:304358 68/231 (29%)
si:dkey-221h15.4NP_001373167.1 17beta-HSDXI-like_SDR_c 47..269 CDD:187598 68/225 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100599
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.