DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ldsdh1 and rdh20

DIOPT Version :9

Sequence 1:NP_572436.1 Gene:Ldsdh1 / 31726 FlyBaseID:FBgn0029994 Length:320 Species:Drosophila melanogaster
Sequence 2:XP_021332944.1 Gene:rdh20 / 555864 ZFINID:ZDB-GENE-131127-122 Length:316 Species:Danio rerio


Alignment Length:276 Identity:91/276 - (32%)
Similarity:153/276 - (55%) Gaps:19/276 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IYNIVLLVVDIVMLIVKFWLAIAEAIVGLFRAPPLDDVNGKVVLITGTGHGMGKEMALQYAKLGA 83
            :.::.::::|::..|::..|.:      :|| |....::|::|||||:|..:|:..||::.|.||
Zfish     4 LMDLQVMLLDVLYFILRSCLRL------VFR-PRTKPIDGELVLITGSGGALGRLFALEFTKHGA 61

  Fly    84 TILCWDVNEQTNNQTVKEIKNNGGKAFGYVCNVTKREELIELAQKVRKEHG-FIHVVVNNAGIMP 147
            .::.||||.:.|..|.|.::..||:|..|..:||||||:...|..||:|.| .:..:|||||::.
Zfish    62 EVVLWDVNGEANEDTAKLVRARGGQAHAYTVDVTKREEVYRTADLVREEVGRDVTYLVNNAGVVA 126

  Fly   148 CHPLLEHTENEIRLMYEINVLSHFWIIQAFLPDMIERNEGSIVALSSCAGLFGLINLVPYCGTKF 212
            ...||:..:..:....::|..:.||.::||||.|.::|.|.|:.::|..|||....:..||.:||
Zfish   127 GERLLDCPDYLLERTLKVNCHALFWTVKAFLPQMKDKNHGHIITIASVLGLFSTACVEDYCASKF 191

  Fly   213 AVRGYMAALVEELRQKNPQNNVKLTTIYPYMIDTGLCKNPRYR------FPNLFKLIPADVAAGS 271
            |..|:..:|..||..:: .:.||.|.:.||::|||:.:..|.|      .|.|..|.....|..:
Zfish   192 AAVGFHESLAHELLTED-LDGVKTTLVCPYIVDTGMFEGCRIREEVALILPPLEPLYCVQQAMNA 255

  Fly   272 IIEAQRQGLEEAAIPR 287
            |:..|    ....|||
Zfish   256 ILIDQ----PLVCIPR 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ldsdh1NP_572436.1 adh_short 59..248 CDD:278532 72/189 (38%)
NADB_Rossmann 60..287 CDD:304358 82/233 (35%)
rdh20XP_021332944.1 17beta-HSDXI-like_SDR_c 38..282 CDD:187598 84/235 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.